PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_29064
Common NameKK1_028433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family G2-like
Protein Properties Length: 396aa    MW: 43703.9 Da    PI: 9.5982
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_29064genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.91.9e-32254309156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rFv+a+++LGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  C.cajan_29064 254 KQRRCWSPELHRRFVNALQKLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 309
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.15251311IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-29252312IPR009057Homeodomain-like
SuperFamilySSF466898.96E-18252312IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-27254309IPR006447Myb domain, plants
PfamPF002493.9E-8256307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGSVPSELSL VLRPSFVPKT ITDFLSQLSS ASDKLATLHD FLARLEDELR KIHAFKRELP  60
LSMLLLNDAI SLLKAESKKC TPVLEEFIPL KKDRDHTHQN HRNDTECTTD KRNWMSSVQL  120
WNNSTTNNNN ASDRKQLHNL ETKKSEEGQS VGEDPFQSCS NRNGGRRAFM PFSRYSSSSS  180
SVPVTTVALA AATKEEKEDS VMNRLSLLTT PSVKEGCGSR GSRSSSNMAV SSSSPPPTVQ  240
PTLRASSLQQ AARKQRRCWS PELHRRFVNA LQKLGGSQAA TPKQIRELMQ VDGLTNDEVK  300
SHLQKYRLHT RRVPASTANQ PVVVLGGLWM SQDQYNDSSK VSSSGSGSPQ SPLHLGAGSR  360
GGTSPTEGDS MEDDEDARSE SYSWKSHMHK PGKIDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510738.10.0PREDICTED: uncharacterized protein LOC106769578
TrEMBLA0A151S5020.0A0A151S502_CAJCA; Two-component response regulator ARR1
STRINGGLYMA02G15320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-52G2-like family protein